Settings
Top sales list settings
India (All cities)
Generic chit fund software is introduced the settings option in chit software, in this features are helpful for chit fund companies. Generic chit fund software solution give to software for admin panel, admin or authorized person can generate the user privilege for our chit company employees. Generic chit fund software can allow the user panel access and generate. Admin person can show the user privilege password, and able to continue or discontinue the password options. Generic chit allow the admin authorized change the user password panel update are delete options. Generic chit online chit software can work world wide anytime, anywhere places access it, it is also work for username password based working. Incase your office staff ML, or relive the company you can change the password, it is prevention for your staff any misuse the software. In this settings options are helpful for chit fund companies. Generic chit fund software fulfil customer requirements and satisfactions. 1)Available Customer Support In Generic Chit Fund Software 2)No Paper Work Using Generic Chit Fund Software 3)CHIT MINUTES GENERIC CHIT FUND 4) Best Generic Chit Fund Software 5) Adjustment System Generic Chit Fund 6) Chit Fund Software Features 7) Terminal Machine Generic Chit fund software 8) Generic Cloud Online Chit Fund Software 9) Improve Your Chit Fund Business With Generic Chit Fund Software 10) Top 6 Benefits In Generic Chit Fund Software 11) All In One Generic Chit Fund Management Software 12) Generic Chit Fund Accounts Software 13) Auction Type Wise Generic Chit Fund Software 14) Difference Between Offline Online Chit Fund Software 15) All Features Are In Your Hand Using Generic Chit Fund Software 16) Save Money Accurate Reports In Generic Chit Fund Software 17) Types Of Generic Chit Fund Software 18) Accurate Reports In Generic Chit Fund Software 19) Online Chit Fund Software Facilities 20) Available Free Demo In Generic Chit Fund Software 21) Achieve Your Targets With Our Generic Chit Funds Software 22) Tension Free Generic Chit Fund Software 23) Generic Online Chit Fund Software Benefits 24) Chit Fund Software Mobile Apps Features 25) Chit Fund Accounting Software Benefits 26) Chit Group Management Features In Generic Chit Fund Software 27) Generic Chit Fund Software Customer Management Features 28) Generic Chit Fund Software Free Demo Download 29) Employee Management Chit Fund Software In Generic Chit 30) Chit Fund Accounting Software Features 31) Bulk SMS Integration On Generic Chit Fund Software 32) Online Auction Chat Available In Generic Chit Fund Software 33) Generic Chits Funds Management Software 34) Digitally Collection Process In Generic Chit Fund Software 35) Achieve Your Targets Our Generic Chit Fund Software 36) Due Notification For Generic Chit Fund Software 37) Chit Fund Software Generic Chit 38) Generic Chit Fund Software Benefits 39) Free Demo Available In Generic Chit Fund Software 40) Time Cost Savings In Generic Chit Fund Software 41) Top 5 Features In Generic Chit Fund Software 42) Chit Fund Accounts Software Generic Chit 43) Chit Fund Software Mobile Apps Free Download Generic Chit 44) Best Chit Fund Software Service Provider In 2021 45) Promote Your Business With Generic Chit Fund Software 46) Best Chit Fund Software Generic Chit 47) Chit Fund Software Mobile Apps Free Demo Generic Chit 48) Features Of Generic Chit Fund Management Software 49) 5 Top Benefits Of Generic Chit Fund Software 50) Customer Feel Happy Using Generic Chit Fund Software For more details call us: +91 9788037825, +91 8098129659, http://chitfundsoftwares.in/ http://genericit.in/
₹ 1
See product
India (All cities)
If you need to change the cox email settings iPhone then you have to use the following step for an update on macOS. So, you can open the mail and click the mail folder. And then click mail and click on the preference folder, after that you can click on the account tab and select your cox email account. Moreover, you can click on the server settings and make sure that your automatically managed connection settings box is unchecked. And then you have to follow the outgoing and incoming mail server just like here, you can enter the incoming mail server is IMAP.COX.NET and the port will be 993, make sure SSL will continue with yes, and you can enter the email address which is registered with cox. After that, you can enter the password of your cox email settings. After that you can cox email settings of outgoing mail server then you have to enter the SMTP.COX.NET And Port will be 465 and the one is 587. And the authentic required is yes. And your cox email settings iPhone is done. FOR MORE INFO - https://coxemaillogin.com/cox-email-settings/
See product
Chandigarh (Chandigarh)
We are Dealing All Electronic Product ..*
MRP :- 25,990
OFFER PRICE :- 9,999
*Brand Voltas
*Colour Grey
*8 Place Settings: : Great for small-sized households (2-3 members)
Removable Rack: Helps you load tall vessels in the 2nd rack
6 Wash Programs: Helps to control time it takes to wash, temperature of water, amount of water and energy saved
Liqo Warehouse
Panchkula
SCO-384 Sector 20 Pkl.
Kharar, Punjab 134117
It's Brand New Condition
Open Box Store
SB KUCH ONLINE SE BHI SASTAA...
See product
Panchkula Urban Estate (Haryana)
*We Deal in All Electronic Product*
* Brand New Product Milega Online Se Bhi Sasta*
MRP - 39990/-
Our Price - 32999/-
Feature's -
12 Place Settings: : Great for medium-sized households (3-4 members)
Removable Rack: Helps you load tall vessels in the 2nd rack
8 Wash Programs: Helps to control time it takes to wash, temperature of water, amount of water and energy saved
Our Address - Liqo Warehouse, Sco - 313-314, Sector - 35B, Chandigarh
See product
India (All cities)
Binary MLM Plan Software | Binary Multi-Level Marketing Plan | BMP MLM features : Binary Multi-Level Marketing plan Software is a web application that helps to manage binary MLM networks such as to keep track on down-line’s incomes , uplines and expenditure. Binary MLM Plan includes a two legged structure where in a parent Node has two sub nodes where each new distributor or members is placed in either left or right sub-tree. One sub-tree is known as a Power Leg or Profit Leg while the second sub-tree is a Profit Leg or a weak leg.. It is one of the basic Binary MLM plan which is required by all the MLM organizations be it small or large. The binary MLM plan helps admin managing users or sub nodes in a binary network to keep record of their income, expenses etc. Features Admin Features Order status selection feature. Feature to be a MLM Customer. Feature Royalty Bonus based on commission amount & pool amount. Commissions based on product point value and product price feature . Eligibility Setting to get commissions. Initial Pair commission settings. Initial pair amount settings. Further Pair commission settings. Further Pair amount settings. Join commission Settings. Direct Referral commission Settings. Service charges settings. Tax deduction Settings. Cap Limit Amount Settings. Bonus settings Based on Pair and direct referral. Royalty Bonus settings . Withdrawal Limit settings(max , min). Email Settings . SMS Configuration Settings . SMS Settings . Payout Reports & User Reports in admin. Feature Withdrawal pay and history in admin. Genealogy representation of the Downlines with username. Run payout - distribute commission &Run Payout . Feature reset MLM plan in admin . Frontend Features Dashboard feature for logged-in customer . Payout listing and detail for logged-in MLM customer. All commission with detail on payout detail page for logged-in MLM customer. Feature Update bank details for logged-in MLM customer. Feature to withdrawal request and request Details on withdrawal request page. Genealogy representation of the MLM customer Downlines in better design. Register MLM customer by registration page . Register MLM customer by genealogy registration . Register MLM customer by checkout registration registration . If you want to know the price of Binary MLM Plan and any queries regarding settings, and features, you can contact us at - Skype: jks0586, Mail: letscmsdev@gmail.com, Website: www.letscms.com, www.mlmtrees.com, Call/WhatsApp/WeChat: +91-9717478599. more information : https://www.mlmtrees.com/product/bmp-opencart Vedio : https://www.youtube.com/watch?v=crtodgbIjJs&list=PLn9cGkS1zw3TUYANIQAsHiEOmmOLWbJTO&index=14 #bmp_mlm_plan, #bmp_mlm_plan_pro, #binary_mlm_plan, #binary_mlm_plan_software, #binary_mlm_plan_ecommerce, #binary_mlm_plan_Woocommerce, #binary_multi_level_marketing_plan, #binary_mlm_calculator, #what_is_binary_mlm_plan
₹ 1
See product
India (All cities)
Binary MLM Calculator Plan | Binary MLM Software : LETSCMS provides you the MLM Binary Calculator for the Binary MLM Software. You can calculate Profit and loss from this calculator. Binary Multi-Level Marketing plan Software is a web application that helps to manage binary MLM networks such as to keep track on down-line’s incomes , uplines and expenditure. Binary MLM Plan includes a two legged structure where in a parent Node has two sub nodes where each new distributor or members is placed in either left or right sub-tree. One sub-tree is known as a Power Leg or Profit Leg while the second sub-tree is a Profit Leg or a weak leg.. It is one of the basic Binary MLM plan which is required by all the MLM organizations be it small or large. The binary MLM plan helps admin managing users or sub nodes in a binary network to keep record of their income, expenses etc. Features Admin Features Order status selection feature. Feature to be a MLM Customer. Feature Royalty Bonus based on commission amount & pool amount. Commissions based on product point value and product price feature . Eligibility Setting to get commissions. Initial Pair commission settings. Initial pair amount settings. Further Pair commission settings. Further Pair amount settings. Join commission Settings. Direct Referral commission Settings. Service charges settings. Tax deduction Settings. Cap Limit Amount Settings. Bonus settings Based on Pair and direct referral. Royalty Bonus settings . Withdrawal Limit settings(max , min). Email Settings . SMS Configuration Settings . SMS Settings . Payout Reports & User Reports in admin. Feature Withdrawal pay and history in admin. Genealogy representation of the Downlines with username. Run payout - distribute commission &Run Payout . Feature reset MLM plan in admin . Frontend Features Dashboard feature for logged-in customer . Payout listing and detail for logged-in MLM customer. All commission with detail on payout detail page for logged-in MLM customer. Feature Update bank details for logged-in MLM customer. Feature to withdrawal request and request Details on withdrawal request page. Genealogy representation of the MLM customer Downlines in better design. Register MLM customer by registration page . Register MLM customer by genealogy registration . Register MLM customer by checkout registration registration . If you want to know the price of Binary MLM Plan and any queries regarding settings, and features, you can contact us at - Skype: jks0586, Mail: letscmsdev@gmail.com, Website: www.letscms.com, www.mlmtrees.com, Call/WhatsApp/WeChat: +91-9717478599. more information : https://www.mlmtrees.com/product/bmp-opencart View Documentation : http://www.letscms.com/documents/opencart-binary-mlm-plan.html#installation Vedio : https://www.youtube.com/watch?v=crtodgbIjJs&list=PLn9cGkS1zw3TUYANIQAsHiEOmmOLWbJTO&index=14 #binary_mlm_plan, #mlm_plan, #bmp_mlm_plan, #bmp_mlm_plan_pro, #binary_mlm_plan, #binary_mlm_plan_software, #binary_mlm_plan_ecommerce, #binary_mlm_plan_Woocommerce, #binary_multi_level_marketing_plan, #binary_mlm_calculator, #what_is_binary_mlm_plan
₹ 1
See product
India (All cities)
Advance Binary MLM Plan | Binary MLM Pro Software & Features : Binary Multi Level Marketing Plan pro Software is a web application that helps to manage binary MLM networks such as to keep track on down-line’s incomes , uplines and expenditure. Binary MLM Plan Pro includes a two legged structure where in a parent Node has two sub nodes where each new distributor or members is placed in either left or right sub-tree. One sub-tree is known as a Power Leg or Profit Leg while the second sub-tree is a Profit Leg or a weak leg.. It is one of the basic Binary MLM plan which is required by all the MLM organizations be it small or large. The binary MLM plan helps admin managing users or sub nodes in a binary network to keep record of their income, expenses etc. Features Admin Features Feature to be a MLM Customer. Eligibility Setting to get commissions. Initial Pair commission settings. Initial pair amount settings. Further Pair commission settings. Further Pair amount settings. Join commission Settings. Direct Referral commission Settings. Service charges settings. Tax deduction Settings. Cap Limit Amount Settings. Bonus settings Based on Pair and direct referral. Withdrawal Limit settings(max , min) . Email Settings . SMS Configuration Settings . SMS Settings . Payout Reports in admin. User Reports in admin. Feature Withdrawal pay in admin. Feature Withdrawal history in admin. Genealogy representation of the Downlines. Genealogy based on user name. Run payout – distribute commission . Run payout – Run Payout . Feature reset all MLM customers data in admin . Feature reset MLM settings data in admin . Feature reset MLM data in admin . Frontend Features It works Based on Binary Rules i.e 1X1, 1X2, 2X1,2X2 etc. Manual Commission calculate feature also in binary mlm plan. Dashboard feature for logged-in customer . Payout listing for logged-in MLM customer. Payout detail of logged-in MLM customer. There are four types of commission i. Join Commission ii. Direct Referral Commission iii. Pair Commission iv. Bonus Commission If you want to know the price of Binary MLM Plan Pro and any queries regarding settings, and features, you can contact us at - Skype: jks0586, Mail: letscmsdev@gmail.com, Website: www.letscms.com, www.mlmtrees.com, Call/WhatsApp/WeChat: +91-9717478599. more information : https://www.mlmtrees.com/product/bmp-pro-wordpress View Documentation : https://www.letscms.com/bmp_pro_documentation/#server-requirements Vedio : https://www.youtube.com/watch?v=ToQ-fZ_RO10&list=PLn9cGkS1zw3Q1ZMo94AT9_RP1IPxnirpb&index=2 #bmp_mlm_pro, #binary_plan_wordpress, #binary_mlm_plan_pro_in_india, #best_binary_mlm_plan_pro, #binary_mlm_pro_compensation_plan, #binary_generation_plan_pro, #binary_system, #binary_ecomerce_plan, #binary_plan_pro_software, #binary_plan_pro_script, #binary_pro_wordpress_plugin, #binary_plan_pro, #binary_plan_pro, #binar_mlm_ecommerce_plan_pro, #binary_mlm_pro_software, #binary_mlm_pro_Web_Application
Free
See product
India (All cities)
LetsCms Pvt. Ltd. presents a Unilevel MLM Plan for OpenCart and offers its web software and services at affordable prices. Visit LetsCms/mlmtrees official website to know about its features like payout settings, bonus settings, royalty bonus settings, payout settings or to know about its works, price, and all extra benefits of this product. Our products and their services are our first priority, so feel free to purchase or to take our services anytime from anywhere. Looking for a business to start but do not have enough capital then here is your solution UMP, which helps you to start your own business from less amount and only your hard and efficient work can grow your business day by day and will give you good returns and we from LetsCms will help you for that to let you know about the products and its feature.
See product
India (All cities)
processor: amd ryzen 5 ram: 16 gb ddr4 graphics card: nvdia gtx 1650 operating system: windows 10 home 64 bit selling cause i got a really expensive pc tested games pubg high settings 80 fps cod black ops 4 high settings 75 fps fortnite epic settings 60 fps got it a week ago got it for 83k tags gaming laptop
See product
Aligarh (Uttar Pradesh)
Affiliate Content Management System (CMS) Network Marketing Software - MLM (Multi-Level Marketing) Software Development Service is a specialized service that involves designing, developing, and implementing a software solution to manage and automate multi-level marketing businesses that operate in multiple languages or regions. MLM businesses & Learning System, also known as network marketing or direct selling, involve selling products or services through a network of distributors or affiliates who earn commissions based on their sales and the sales of their downline. https://www.mlmtrees.com/ Multi-language MLM software development service caters to MLM businesses that operate in different countries, regions, or language groups, where language diversity is a crucial factor. It typically includes features such as multi-language support, multi-currency support, and localization to ensure that the MLM software is capable of handling different languages, currencies, and cultural nuances of different markets. Create MLM Software Plugin – Binary mlm, Unilevel mlm, Monoline mlm, Force Matrix MLM Plan, REST API with WooCommerce, Learning Managemnet System - LMS LearnPress. Features of MLM Software Email Settings. SMS Settings. Payout Reports in the admin. Feature Withdrawal pay in the admin. Genealogy representation of the Downlines. Genealogy is based on the user name. Run payout – distribute commission. There are five types of commission i. Join Commission ii. Direct Referral Commission iii. Level or Pair Commission iv. Bonus Commission v. Royalty Commission If you want to know the price of Multi-Level Marketing [MLM] Software and any queries regarding settings, and features, you can contact us at - Skype: jks0586, Email id: letscmsdev@gmail.com, Website: www.letscms.com, www.mlmtrees.com, Call/WhatsApp/WeChat: +91-9717478599. Support 24X7, #mlm_documentations: http://www.letscms.com/documentations #mlm_Video: https://www.youtube.com/watch?v=yH02L3tu4PQ&t=22s #marketing #multilevelmarketing #directselling #networkmarketing #affiliatemlm #wpaffiliate #affiliatemlmwordpressplugin #mlmaffiliateprograms #mlmaffiliatesoftware #mlmaffiliatescript #affiliatewpmlm #wordpressaffiliatemlm #woocommercemlmaffiliateplugin #bestmlmaffiliateprograms #affiliateandnetworkmarketing #affiliatemarketingandmlm #differencebetweenmlmandaffiliatemarketing #affiliatemarketingvspyramidscheme #wpaffiliate #mlmsoftware #mlmsoftwareonline #mlmsoftwaredemo #mlmsoftwaredownload #mlmsoftwareprice #mlmsoftwaredevelopment #binarymlmsoftware #cheapmlmsoftware
₹ 1
See product
4 photos
India (All cities)
Free Live Demo Available Mlm Software Plugins, Code & Scripts - MLM (Multi-Level Marketing) Software Development Service is a specialized service that involves designing, developing, and implementing a software solution to manage and automate multi-level marketing businesses that operate in multiple languages or regions. MLM businesses, also known as network marketing or direct selling, involve selling products or services through a network of distributors or affiliates who earn commissions based on their sales and the sales of their downline. https://www.mlmtrees.com/ Multi-language MLM software development service caters to MLM businesses that operate in different countries, regions, or language groups, where language diversity is a crucial factor. It typically includes features such as multi-language support, multi-currency support, and localization to ensure that the MLM software is capable of handling different languages, currencies, and cultural nuances of different markets. Create MLM Software Plugin – Binary mlm, Unilevel mlm, Monoline mlm, Force Matrix MLM Plan, REST API with WooCommerce. Features of MLM Software Email Settings. SMS Settings. Payout Reports in the admin. Feature Withdrawal pay in the admin. Genealogy representation of the Downlines. Genealogy is based on the user name. Run payout – distribute commission. There are five types of commission i. Join Commission ii. Direct Referral Commission iii. Pair Commission iv. Regular Bonus v. Royalty Bonus If you want to know the price of Multi-Level Marketing [MLM] Software and any queries regarding settings, and features, you can contact us at - Skype: jks0586, Email id: letscmsdev@gmail.com, Website: www.letscms.com, www.mlmtrees.com, Call/WhatsApp/WeChat: +91-9717478599. Support 24X7, #mlm_documentations: http://www.letscms.com/documentations #mlm_Vedio: https://www.youtube.com/watch?v=NuTsGooaA94&t=3s #mlmsoftware #mlmsoftwareonline #mlmsoftwaredemo #mlmsoftwaredownload #mlmsoftwareprice #mlmsoftwaredevelopment #binarymlmsoftware #cheapmlmsoftware #unimatrixmembershipmlmscript #mlmandroidappsourcecode #mlmplugins #mlmpluginforwordpress #matrixmlmwordpressplugin #woocommercemlmplugin #mlmsoftwaregithub #UnilevelMLMsoftwareplan #MLMMatrix #automaticmlmresponder #softwaremlmbinary #binarymlmsoftware
See product
2 photos
India (All cities)
Being the leading company, we are affianced in providing a wide gamut of DSX-HCF Series Hi Speed Closed Loop Servo Tensioner that is known for its high efficiency and excellent quality. The given servo tensioner features a large screen HD LCD panel for multiple data settings and display. Clear multiple data display, real-time communication and tension range preset function are qualities of offered loop servo tensioner. This DSX-HCF Series Hi Speed Closed Loop Servo Tensioner can be purchased from us at reasonable rates within the promised time period. More Details The DSX - HCF series features high speed closed loop servo Tensioners with a maximum wire - feeding speed of 15 meters per second. Its high speed/high torque DC servo motor and built - in Adaptive Speed Control software provides fast response to rapid changes in coil winding speed and a wider Tension range for Hi-speed precision winding.It features a large screen HD LCD panel for multiple data settings and display. Standard configurations for this series includes a built-in tension measurement system, two-stage tensions setting and wire breakage detection. The series operates with DC24V. Advantages Precise, stable and consistent tension for hi -speed precision winding Two stage tension setting Wide tension range Comes with real-time tension measurement and display Requirements Power supply: DC 24V Compressed air. 5kg/cm2
See product
Bhadravati-Karnataka (Karnataka)
Find Classified ad details Back Print Dell Precision T7810 Workstation Rental Bangalore Peak performance ena - Computers for sale, Accessories for sale Ref. number: 2331138 Updated: 01-10-2016 04:47 Offering: Computers for sale, Accessories for sale in India, Karnataka Dell Precision T7810 Workstation Rental Bangalore Peak performance enabled. Different applications have different system requirements. Let Dell Precision Optimizer take the guesswork out of customizing settings by automatically adjusting system settings. Processor:2 * Intel Xeon Processor E5-2620 v3 (Six Core HT, 10MB Cache, 3.5GHz Turbo) RAM:32GB (4x8GB) DDR4 Ram Storage:2TB Hard Drive Graphics: Nvidia Quadro M6000 12GB OS: Windows(R) 8.1 Pro Contact us:Globalnet technologies Mobile no: +91 90360 10005, Office no: 080-65707504, Email address: enquiry@globalnetech.in, http://globalnetech.in/
See product
Indore (Madhya Pradesh)
Gtx 1070 with bill and box included working in excellent condition 1 year old. Can run all modern games on 1080p with ultra settings. Best graphics card in the market.
8GB 256-Bit GDDR5
Core Clock 1607 MHz
Boost Clock 1797 MHz
1 x Dual-Link DVI-D 1 x HDMI 2.0b 3 x DisplayPort 1.4
1920 CUDA Cores
PCI Express 3.0
Capable of running games on ultra settings at 60pfs.
See product
India (All cities)
Buying a good beard trimmer is necessary for keeping your facial hair in check. Remodel your beard to the shape and style you want with our brand new Philips BT3105/15 Beard Trimmer. The Philips Trimmer packs in a ton of amazing features, including 20 Integrated Trimming Length Settings, and the device has Range of length settings from 0.5 up to 10 mm. This beast of a trimmer is the ultimate piece of hardware for shaping the perfect beard. It comes with a Cleaning brush, a Storage pouch, Lift & Trim system, and stainless Steel Blades in the box, giving you Long-lasting Sharpness. You can separate the trimmer's head for easy rinsing and cleaning and dry it before putting it back on the device. It contains DuraPower technology that ensures a long-lasting battery life and offers Skin-friendly blades for sensitive skin exclusively. Charge this Philips BT3105/15 Beard trimmer for 2 hours and get 45 minutes of cordless use. The battery indicators notify you of its status. There's even a travel pouch to protect your device during travel. This trimmer comes in two different variants of black and blue. The price of the Philips BT3105/15 Beard Trimmer starts from Rs.1,789 at Poorvika. Click here to know more: https://www.poorvikamobile.com/philips-beard-trimmer-bt3105-15-black-blue
See product
India (All cities)
Server offers distinguishing features at rentals. The following feature gives clear idea about server rentals and configuration settings. There are different server rental plans for different configuration settings as per organizations needs and specifications. We at Sumo Technologies, Provide Assembled or Branded Server on Rent offering a wide range of servers for operating systems (OS) like Windows / Linux / Unix etc.
See product
India (All cities)
Enjoy the Full Power of your Computer Of Eset Nod32 version 10. Gamer Mode saves system resources by switching to silent mode for gaming, movies or presentations. Portable Computer Support postpones all nonactionable pop-up windows, updates and system hungry activities to preserve system resources so that you can stay online and unplugged longer. Install and Forget or Customize to Meet your Exact Requirements One-click Solution lets you view your protection status and access the most frequently used tools from all screens. Offers comprehensive, one-click solutions to potential issues. Settings for Advanced Users offers in-depth security settings to fit your needs.
₹ 899
See product
Kochi (Kerala)
Recently bought graphics card. Ordered the card on 31st August 2022. Available with box and bill. Card has been registered online and now has 4 years of warranty till September 2026 as shown in one of the pics. Very rarely used so far. Perfect graphics card for 1080p or 1440p ultra/high settings gaming. Also good for 4K gaming at medium/high settings.
Reason for selling: need cash
See product
India (All cities)
Enjoy the Full Power of your Computer Of Eset Nod32 version 10. Gamer Mode saves system resources by switching to silent mode for gaming, movies or presentations. Portable Computer Support postpones all nonactionable pop-up windows, updates and system hungry activities to preserve system resources so that you can stay online and unplugged longer. Install and Forget or Customize to Meet your Exact Requirements One-click Solution lets you view your protection status and access the most frequently used tools from all screens. Offers comprehensive, one-click solutions to potential issues. Settings for Advanced Users offers in-depth security settings to fit your needs. Toll Free: 1800-209-2016, Paid Line: 9272222081, Email id: eset.support@sakri.in
₹ 352
See product
Pune (Maharashtra)
8,000 DPI gaming-grade sensor responds precisely to movements. Customize your sensitivity settings to suit the sensitivity you like with Logitech G HUB gaming software and cycle quickly through up to 5 DPI settings.
Play in color with our most vibrant LIGHTSYNC RGB featuring color wave effects customizable across 16.8 million colors. Install Logitech G HUB software to choose from preset colors and animations or make your own. Game-driven, audio visualization, and screen mapping options are also available.
Play comfortably and with total control. The classic and simple 6-button layout and classic gaming shape is a comfortable time-tested and loved design. Each button can be customized using Logitech G HUB software to simplify tasks.
Primary buttons are mechanical and tensioned with durable metal springs for reliability, performance, and excellent feel. The crisp clicks and precise feedback deliver a great precision feel to maximize your fun in the game.; Hardware Platform: Pcmac; Style Name: Mouse Only; Power Source Type: Corded Electric
See product
Tambaram (Tamil Nadu)
*12 place settings::great for medium sized family(3-4members)
*Removable rack:helps you load tall vessels in the 2nd rack
*6wash program; helps to control time it takes to wash ,temperature of water, amount of water and energy saved capacity: 12 place settings
Color:white
Wash program type:intensive,self clean, eco,90 minutes,glass,rapid
Number of raks 2
removable rack
half years warranty available
See product
India (All cities)
LAZYwindow Premium Quality Telescopic Portable Electric Fan. This innovative fan is designed to provide you with refreshing airflow and ultimate convenience. Whether you're at home, in the office, or enjoying outdoor activities, this fan ensures you remain cool and comfortable. Key Features: Telescopic Design: The extendable telescopic pole allows you to adjust the fan's height according to your needs. It's perfect for use on desks, tables, and floors. 3-Speed Settings: Customize your cooling experience with three speed settings: low, medium, and high. Easily switch between speeds to find the perfect breeze. USB Powered: This fan is powered by a USB cable, making it highly versatile. Connect it to your laptop, power bank, or any USB-compatible device for continuous use. Portable and Compact: Lightweight and compact, this fan is easy to carry and store. It's an ideal companion for travel, camping, and other outdoor adventures. Quiet Operation: Enjoy a powerful breeze without the noise. The fan operates quietly, ensuring it doesn't disturb your work or sleep. Adjustable Angle: The fan head can be tilted to direct airflow exactly where you need it, providing targeted cooling.
₹ 478
See product
Chennai (Tamil Nadu)
Call 9791092909 to buy hp Deskjet Ink Advantage 6525 eAIO Printer CZ276B price in Chennai. This all-in-one lets you affordably print high-quality documents, using low-cost Original HP ink cartridges. Features Low-cost inks to fuel new possibilities • Print for less with low-cost Original HP inks and the best-selling printer brand for more than 20 years. • Create lab-quality, fade-resistant photos without borders, as well as archive-quality documents. • Print, copy, scan, and access web content from the (), gesture-enabled touchscreen. • Automatically print and copy on both sides of a single page. Wireless printing and connectivity—on the go • HP ePrint—now you can print from virtually anywhere using your smartphone or tablet and stay productive and connected when you are on the go. • Easily print and share, using built-in wireless, and connect quickly with HP Auto Wireless Connect. • Download convenient, free apps from HP and partners to wirelessly print directly from your smart phone. • Print from wireless-enabled mobile devices—without a network—by using wireless direct printing. Handle your whole project—without a PC • Tap and swipe the () colour touch screen to easily print, copy, scan, and access web content. • Scan photos and everyday documents to your email account—even scan multiple pages to a single file. • Easy photo printing—keep photo paper loaded and ready, and use the memory card slots to walk up and print. Easily save paper and energy • Responsibly designed—this ENERGY STAR® qualified e-All-in-One is made of 20% post-consumer recycled plastics. • The HP Eco App installed on your touch screen makes it easy to adjust key energy- and paper-saving settings. • Consume up to 50% less paper, using automatic two-sided printing and copying Warranty Information 1 year on-site warranty(Including Printhead) Authorised HP Printer dealers in Chennai offering you free home delivery and installation with better service support, having 12+ years experience, exceptional values to clients through effective development cost, which in turn help clients to improve their productivity. All our resources and processes are dedicated to ensure that the solutions developed are of the highest quality and are designed to accommodate the future needs. Contact us on 9791091909 or log on http://chennaisystems.com
₹ 11,98
See product
Chennai (Tamil Nadu)
Call 9791091909 to buy ncomputing NComputing X550 turn-key solution for up to 11 users per PC in Chennai. The X-series direct connect, desktop virtualization kits enable up to 11 eleven users to simultaneously share a single PC at a fraction of the cost of a typical PC. Each user enjoys their own virtual workspace complete with their own applications, settings, files and preferences providing each user with a rich PC experience. • Easy to Install – With each kit including vSpace Server desktop virtualization software, a PCI card and client access devices, set up is simple and easy. • Powerful and Flexible – Software applications run simultaneously and independently on each virtual desktop. The access devices are small, silent and mount on the back of the monitor giving each user a rich Windows or Linux experience enjoying multimedia with sound and full-motion video. • Economical and Efficient – Share one PC with up to 11 users and lower your computer hardware and support costs by up to 75%. • Green and Clean –Uses only 1 watt of energy per user, and weighing in at just a few ounces, greatly reduces your e-waste. Authorised ncomputing dealers in Chennai offering you free home delivery and installation with better service support, having 12+ years experience, exceptional values to clients through effective development cost, which in turn help clients to improve their productivity. All our resources and processes are dedicated to ensure that the solutions developed are of the highest quality and are designed to accommodate the future needs. Contact us on 9791091909 or log on http://chennaisystems.com
₹ 16,29
See product
Chennai (Tamil Nadu)
Call 9791091909 to buy PowerEdge T620 at best price in Chennai. The Dell Power Edge R220 is a compact, versatile 1-socket 1U rack server featuring intuitive management, quiet acoustics and efficient performance. Save space with a short-depth chassis, save time with intuitive management using a quiet, 1U 1-socket server. Install your server in a wide range of settings, thanks to a short chassis depth of (15.5") that makes the R220 more compact than competitive servers2. Easily deploy in a short-depth rack, on a countertop or in a data center and have ample space for cabling or for connecting devices to the 5 USB ports. Quiet, office-level acoustics make this server ideal for open-office environments and can reduce noise in data centers. PowerEdge R220 Intel Xeon E3-1220 v3 3.1GHz, 8M Cache, Turbo, 4C/4T, 80W 8GB UDIMM, Low Volt, Dual Rank, x8 Data Width 500GB 3.5-inch 7.2K RPM SATA II Hard Drive - Non Hotplug Embedded SATA (1-2 HDD) iDRAC7 Express 3 Yr Next Business Day Onsite Service DVD Chassis with up to 2 Cabled Hard Drives (2.5" or 3.5") Authorised dell server dealers in Chennai offering you wide range of dell tower and servers. Call 9791092909 or log on http://chennaisystems.com
₹ 73,98
See product
Chennai (Tamil Nadu)
Call 9841480368 to buy ncomputing NComputing X550 turn-key solution for up to 11 users per PC in Chennai. The X-series direct connect, desktop virtualization kits enable up to 11 eleven users to simultaneously share a single PC at a fraction of the cost of a typical PC. Each user enjoys their own virtual workspace complete with their own applications, settings, files and preferences providing each user with a rich PC experience. • Easy to Install – With each kit including vSpace Server desktop virtualization software, a PCI card and client access devices, set up is simple and easy. • Powerful and Flexible – Software applications run simultaneously and independently on each virtual desktop. The access devices are small, silent and mount on the back of the monitor giving each user a rich Windows or Linux experience enjoying multimedia with sound and full-motion video. • Economical and Efficient – Share one PC with up to 11 users and lower your computer hardware and support costs by up to 75%. • Green and Clean –Uses only 1 watt of energy per user, and weighing in at just a few ounces, greatly reduces your e-waste. Authorised ncomputing dealers in Chennai offering you free home delivery and installation with better service support, having 12+ years experience, exceptional values to clients through effective development cost, which in turn help clients to improve their productivity. All our resources and processes are dedicated to ensure that the solutions developed are of the highest quality and are designed to accommodate the future needs. Contact us on 950009123 or log on http://chennaisystems.com
₹ 16.290
See product
Chennai (Tamil Nadu)
Call 9841480368 to buy Power Edge T620 at best price in Chennai. The Dell Power Edge R220 is a compact, versatile 1-socket 1U rack server featuring intuitive management, quiet acoustics and efficient performance. Save space with a short-depth chassis, save time with intuitive management using a quiet, 1U 1-socket server. Install your server in a wide range of settings, thanks to a short chassis depth of (15.5") that makes the R220 more compact than competitive servers2. Easily deploy in a short-depth rack, on a countertop or in a data center and have ample space for cabling or for connecting devices to the 5 USB ports. Quiet, office-level acoustics make this server ideal for open-office environments and can reduce noise in data centers. Power Edge R220 Intel Xeon E3-1220 v3 3.1GHz, 8M Cache, Turbo, 4C/4T, 80W 8GB UDIMM, Low Volt, Dual Rank, x8 Data Width 500GB 3.5-inch 7.2K RPM SATA II Hard Drive - Non Hotplug Embedded SATA (1-2 HDD) iDRAC7 Express 3 Yr Next Business Day Onsite Service DVD Chassis with up to 2 Cabled Hard Drives (2.5" or 3.5") Authorised dell server dealers in Chennai offering you wide range of dell tower and servers. Call 950090123 or log on http://chennaisystems.com
₹ 73.990
See product
Chennai (Tamil Nadu)
Call 9841480368 to buy PowerEdge R220 at best price in Chennai. The Dell Power Edge R220 is a compact, versatile 1-socket 1U rack server featuring intuitive management, quiet acoustics and efficient performance. Save space with a short-depth chassis, save time with intuitive management using a quiet, 1U 1-socket server. Install your server in a wide range of settings, thanks to a short chassis depth of (15.5") that makes the R220 more compact than competitive servers2. Easily deploy in a short-depth rack, on a countertop or in a data center and have ample space for cabling or for connecting devices to the 5 USB ports. Quiet, office-level acoustics make this server ideal for open-office environments and can reduce noise in data centers. Intel(R) Xeon(R) E3-1220 Processor/8GB/500GB/DVD ROM /3 Years NBD o Intel® Xeon® E3-1220 v3 3.1GHz, 8M Cache, Turbo, 4C/4T, 80W o No Operating System o 8GB UDIMM, Low Volt, Dual Rank, x8 Data Width o 500GB 7.2k RPM SATA 6Gbps Entry 3.5in Cabled Hard Drive o No MonitorOn-board SATA Controller, Min.1 Max. 2 SATA Hard Drives o Dual Port Network Card 6 4 PCIe G2 slots o Optical Drive o Single Hot Plug Power Supply 350W o Chassis with up to 8 x 3.5" Hot Plug Hard Drives o 3 Years Next Business Day Onsite Service Authorised dell server dealers in Chennai offering you wide range of dell tower and servers. Call 9841480368 or log on http://chennaicomputers.co.in
₹ 73.990
See product
Tambaram (Tamil Nadu)
Proposal for INtools Training (Smart Plant Instrumentation, Version 7.0) Greetings of the day! We are grateful for your interest in our training services. Cell No: +91 - 9677116760, Smart Plant Instrumentation (INTOOLS V7) Intergraph's instrument and controls design module is called 'Smartplant Instrumentation or SPI. It was previously known as INTOOLS. It is intended to cover all of the instrument and control design requirements in a modern industrial plant. It is also intended to be a replacement for Auto CAD in producing I&C Deliverables such as loop diagrams, control wiring diagrams and installation details. This Course is designed for instrumentation specialist involved in the definition and specification of instrumentation and control system using the smart plant instrumentation software. In this course, students learn how to define the instruments using smart plant instrumentation as per the specifications of project deliverable. Topics Covered: Introduction of INtools & Auto Cad Introduction of system administration Introduction of domain administration System and Project Administration Overview Creating new user, domain, owner, plant, area, unit in Admin Module Significance of INtools Instrument Index Module User Report Interface (Browser Module) Process Data Module Calculations Module Binder Module Specifications Module Loop Diagrams Hookups Wiring Module (Foundation fieldbus) Micro Station V8 2004 Edition sets the direction for the continued evolution of Bentley's “V8 Topics Covered: Introduction to Micro station Micro station File Management Drawing creation Seed Files & Work Space Tool bars Attributes Primary & Secondary Information’s Levels Snap Tool bar Menu bars & elements Cells, Dimensions, Line Style, Models, Tags Multi-line Style, Text Style, Key-in, Customize Element Manipulation and Modification Tools Settings Color Table, Design File, Workspace Preferences Function Keys & its Customization Button Assignments and Views Advance 2D Drafting Techniques Sample Project Eligibility: M.Tech/BE Or B.Tech/Dip. Disciplines: E&Inst/E&Control/Elec/Inst. Duration of the course: 15 Days Course fee: Total Cost: Rs. 40,000 Kindly contact me if you need further clarification on this. I am waiting for your response. We look forward to seeing you come for our training(s). Should you have any query, please feel free to contact me Cell No: +91 - 9677116760,
Free
See product
Chennai (Tamil Nadu)
Call 9677003366 to buy Dell 3030 Dual Core All in one in Chennai. The OptiPlex 3030 All-in-One is Dell’s newest all-in-one solution that meets the needs of your students and your school system. The OptiPlex 3030 All-in-One is thin, space saving and clutter free, with a 19.5” WLED touch screen as well as dual display capabilities that meets the practical and performance needs of educational settings. Not only is this all-in-one thinner and takes up less space on a desk than the previous generation; with a wireless keyboard and mouse, and a port cover that locks cables in place, this desktop keep s students focused on the task at hand. Authorised Dell laptop desktop computer dealers in Chennai offering you free home delivery and installation with better service support, having 12+ years experience, exceptional values to clients through effective development cost, which in turn help clients to improve their productivity. All our resources and processes are dedicated to ensure that the solutions developed are of the highest quality and are designed to accommodate the future needs. Contact us on 9677003366 or log on http://chennaisystems.com
₹ 31.990
See product
-
Next →